Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Proximity ligation assay [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001398-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001398-D01P, RRID:AB_1673291
- Product name
- CRK purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CRK protein.
- Antigen sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVF
LVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP
VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYK
IHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL
FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDS
EGKRGMIPVPYVEKYRPASASVSALIGGR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CRK expression in transfected 293T cell line (H00001398-T02) by CRK MaxPab polyclonal antibody.Lane 1: CRK transfected lysate(22.90 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to CRK on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRK and SOS1. HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CRK and SHC1. Mahlavu cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-SHC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)