HPA000884

MPP1 antibody from Sigma-Aldrich
DXS552E, PEMP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000884, RRID:AB_1079406
Product name
Anti-MPP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000884
Antibody type
Polyclonal
Antigen
55 kDa erythrocyte membrane protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIH
KQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQ
GTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVD
ETLKKLQEAFDQACSS
Storage
-20C
Provider Type Product Number
- No reagents -