Antibody data

Product number
H00001019-M08A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001019-M08A, RRID:AB_1204128
Product name
CDK4 monoclonal antibody (M08A), clone 3E7
Provider product page
Abnova Corporation - H00001019-M08A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDK4.
Antigen sequence
KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLP
RGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNP
HKRISAFRALQHSYLHKDEGNPE
Isotype
IgG
Antibody clone number
3E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -