H00001991-M05A

ELANE antibody from Abnova Corporation
ELA2, HLE, HNE, NE
No application information provided.

Antibody data

Product number
H00001991-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001991-M05A, RRID:AB_1204310
Product name
ELA2 monoclonal antibody (M05A), clone 3E5
Provider product page
Abnova Corporation - H00001991-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ELA2.
Antigen sequence
VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDS
GSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQ
FVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Isotype
IgG
Antibody clone number
3E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -