HPA015066

CYP2C9 antibody from Atlas Antibodies
CYP2C10, P450IIC9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015066
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015066, RRID:AB_1234081
Product name
Anti-CYP2C9
Provider product page
Atlas Antibodies - HPA015066
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFT
IENLVITAADLLGAGTETTST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -