Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502228 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Insulin-Like Growth Factor Binding Protein, Acid Labile Subunit (IGFALS) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQL
GHNRI RQLAERSFEG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Primary acid-labile subunit deficiency due to recessive IGFALS mutations results in postnatal growth deficit associated with low circulating insulin growth factor (IGF)-I, IGF binding protein-3 levels, and hyperinsulinemia.
Heath KE, Argente J, Barrios V, Pozo J, Díaz-González F, Martos-Moreno GA, Caimari M, Gracia R, Campos-Barros A
The Journal of clinical endocrinology and metabolism 2008 May;93(5):1616-24
The Journal of clinical endocrinology and metabolism 2008 May;93(5):1616-24
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting