Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502194 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chemokine (C-X-C Motif) Receptor 2 (CXCR2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLD
AAPCE PESLEINKYF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Antisense therapy against CCR3 and the common beta chain attenuates allergen-induced eosinophilic responses.
Gauvreau GM, Boulet LP, Cockcroft DW, Baatjes A, Cote J, Deschesnes F, Davis B, Strinich T, Howie K, Duong M, Watson RM, Renzi PM, O'Byrne PM
American journal of respiratory and critical care medicine 2008 May 1;177(9):952-8
American journal of respiratory and critical care medicine 2008 May 1;177(9):952-8
No comments: Submit comment
No validations: Submit validation data