ABIN502194

CXCR2 antibody from antibodies-online
CD182, CMKAR2, IL8RB

Antibody data

Product number
ABIN502194
Provider
antibodies-online
Product name
anti-Chemokine (C-X-C Motif) Receptor 2 (CXCR2) (N-Term) antibody
Provider product page
antibodies-online - ABIN502194
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLD
AAPCE PESLEINKYF
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -