HPA026574

PRKCI antibody from Sigma-Aldrich
DXS1179E, PKCI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026574
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026574, RRID:AB_1855428
Product name
Anti-PRKCI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026574
Antibody type
Polyclonal
Antigen
Protein kinase C iota type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQS
SMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRE
SGKASSSLGLQDFDLLRV
Storage
-20C
Provider Type Product Number
- No reagents -