ABIN786320

INPP5D antibody from antibodies-online
hp51CN, SHIP, SHIP1

Antibody data

Product number
ABIN786320
Provider
antibodies-online
Product name
anti-Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D) (C-Term) antibody
Provider product page
antibodies-online - ABIN786320
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELP
HHGKH RPEEGPPGPL
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -