H00001739-M01A

DLG1 antibody from Abnova Corporation
dJ1061C18.1.1, DLGH1, hdlg, SAP-97, SAP97
No application information provided.

Antibody data

Product number
H00001739-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001739-M01A, RRID:AB_1204275
Product name
DLG1 monoclonal antibody (M01A), clone 1D8
Provider product page
Abnova Corporation - H00001739-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DLG1.
Antigen sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIE
RVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRS
KPSEPIQPVNTWEISSLPSS
Isotype
IgG
Antibody clone number
1D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -