H00001739-M01A
antibody from Abnova Corporation
Targeting: DLG1
dJ1061C18.1.1, DLGH1, hdlg, SAP-97, SAP97
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001739-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001739-M01A, RRID:AB_1204275
- Product name
- DLG1 monoclonal antibody (M01A), clone 1D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DLG1.
- Antigen sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIE
RVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRS
KPSEPIQPVNTWEISSLPSS- Isotype
- IgG
- Antibody clone number
- 1D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data