WH0001521M1

CTSW antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
WH0001521M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001521M1, RRID:AB_1840484
Product name
Monoclonal Anti-CTSW antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001521M1
Antibody type
Monoclonal
Antigen
CTSW (AAH48255, a.a. 22-377) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSP
EEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPF
SDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEE
SVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGN
IETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFV
WDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKY
QKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINM
KPLQLYRKGV (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -