Antibody data

Product number
H00001521-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001521-M01, RRID:AB_606106
Product name
CTSW monoclonal antibody (M01), clone 4A8
Provider product page
Abnova Corporation - H00001521-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CTSW.
Antigen sequence
IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSP
EEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPF
SDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEE
SVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGN
IETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFV
WDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKY
QKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINM
KPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSV
KSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQ
WGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPR
VSCPP
Isotype
IgG
Antibody clone number
4A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -