H00000176-M01

ACAN antibody from Abnova Corporation
AGC1, CSPG1, CSPGCP, MSK16

Antibody data

Product number
H00000176-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000176-M01, RRID:AB_509201
Product name
AGC1 monoclonal antibody (M01), clone 2A8
Provider product page
Abnova Corporation - H00000176-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AGC1.
Antigen sequence
PMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVAT
EGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRS
NDSGVYRCEVMHGIEDSEATLEVVVKGIVF
Isotype
IgG
Antibody clone number
2A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -