Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000211-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000211-M01, RRID:AB_518647
- Product name
- ALAS1 monoclonal antibody (M01), clone 3G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALAS1.
- Antigen sequence
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPK
MMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKT
AKAKVQQTPDGSQQSPDGTQLPSGHPLP- Isotype
- IgG
- Antibody clone number
- 3G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PGC-1alpha is not mandatory for exercise- and training-induced adaptive gene responses in mouse skeletal muscle.
Leick L, Wojtaszewski JF, Johansen ST, Kiilerich K, Comes G, Hellsten Y, Hidalgo J, Pilegaard H
American journal of physiology. Endocrinology and metabolism 2008 Feb;294(2):E463-74
American journal of physiology. Endocrinology and metabolism 2008 Feb;294(2):E463-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ALAS1 monoclonal antibody (M01), clone 3G10 Western Blot analysis of ALAS1 expression in JAR ( Cat # L003V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ALAS1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol