Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001848-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001848-M01, RRID:AB_489708
- Product name
- DUSP6 monoclonal antibody (M01), clone 3G2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant DUSP6.
- Antigen sequence
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLL
LMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN
LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDW
NENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQ
AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSD
SSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI
LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPN
LFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID
EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLS
MNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS
SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST- Isotype
- IgG
- Antibody clone number
- 3G2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TSH signaling overcomes B-RafV600E-induced senescence in papillary thyroid carcinogenesis through regulation of DUSP6.
Dual specificity phosphatase 6 as a predictor of invasiveness in papillary thyroid cancer.
Down-regulation of DUSP6 expression in lung cancer: its mechanism and potential role in carcinogenesis.
Kim YH, Choi YW, Han JH, Lee J, Soh EY, Park SH, Kim JH, Park TJ
Neoplasia (New York, N.Y.) 2014 Dec;16(12):1107-20
Neoplasia (New York, N.Y.) 2014 Dec;16(12):1107-20
Dual specificity phosphatase 6 as a predictor of invasiveness in papillary thyroid cancer.
Lee JU, Huang S, Lee MH, Lee SE, Ryu MJ, Kim SJ, Kim YK, Kim SY, Joung KH, Kim JM, Shong M, Jo YS
European journal of endocrinology / European Federation of Endocrine Societies 2012 Jul;167(1):93-101
European journal of endocrinology / European Federation of Endocrine Societies 2012 Jul;167(1):93-101
Down-regulation of DUSP6 expression in lung cancer: its mechanism and potential role in carcinogenesis.
Okudela K, Yazawa T, Woo T, Sakaeda M, Ishii J, Mitsui H, Shimoyamada H, Sato H, Tajiri M, Ogawa N, Masuda M, Takahashi T, Sugimura H, Kitamura H
The American journal of pathology 2009 Aug;175(2):867-81
The American journal of pathology 2009 Aug;175(2):867-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DUSP6 expression in transfected 293T cell line by DUSP6 monoclonal antibody (M01), clone 3G2.Lane 1: DUSP6 transfected lysate(42 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DUSP6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DUSP6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to DUSP6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol