Antibody data

Product number
H00009255-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009255-M05, RRID:AB_1112301
Product name
SCYE1 monoclonal antibody (M05), clone 3H5
Provider product page
Abnova Corporation - H00009255-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SCYE1.
Antigen sequence
MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEK
AILQATLREEKKLRVENAKLKKEIEELKQELIQAE
IQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTV
SSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQS
IAGSADSKPIDVSRLDLRIGCIITARKHPDADSLY
VEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILL
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGS
VPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT
NDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Isotype
IgG
Antibody clone number
3H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -