HPA018476

AIMP1 antibody from Sigma-Aldrich
EMAP-2, EMAPII, p43, SCYE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018476, RRID:AB_1848137
Product name
Anti-SCYE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018476
Antibody type
Polyclonal
Antigen
Multisynthetase complex auxiliary component p43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGS
VPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT
NDECVATYKGVPFEVKGKGVCRAQTMSNSGI
Storage
-20C
Provider Type Product Number
- No reagents -