HPA018476

AIMP1 antibody from Atlas Antibodies
EMAP-2, EMAPII, p43, SCYE1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA018476
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018476, RRID:AB_1848137
Product name
Anti-AIMP1
Provider product page
Atlas Antibodies - HPA018476
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGS
VPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT
NDECVATYKGVPFEVKGKGVCRAQTMSNSGI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -