PAB29500
antibody from Abnova Corporation
Targeting: TCF3
bHLHb21, E2A, E47, ITF1, MGC129647, MGC129648, p75, VDIR
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29500 - Provider product page
- Provider
- Abnova Corporation
- Product name
- TCF3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- TCF3 polyclonal antibody raised against recombinant human TCF3.
- Antigen sequence
RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGA
YASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSG
MKGTSQYYPS- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of MCF-7 cells with TCF3 polyclonal antibody (Cat# PAB29500) under 1-4 ug/mL working concentration shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with TCF3 polyclonal antibody (Cat# PAB29500) shows strong nuclear positivity in a subset of cells in seminiferus ducts at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)