HPA031169

antibody from Atlas Antibodies

Targeting: ITGA2B CD41, CD41B, GP2B, PPP1R93

Antibody data

Submit

Validation data

Product number: HPA031169 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031169, RRID:AB_10669671
Product name: Anti-ITGA2B
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFL GLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSN PEYFDGYWGYSVAVGEFDGDLNTTEYVVG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ITGA2B protein structure - HPA031169 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human bone marrow and stomach tissues using Anti-ITGA2B antibody. Corresponding ITGA2B RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, colon, liver and lymph node using Anti-ITGA2B antibody HPA031169 (A) shows similar protein distribution across tissues to independent antibody HPA031168 (B).
Antibody #2 product nr: HPA031170, HPA031171, HPA031168
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ITGA2B antibody HPA031169.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ITGA2B antibody HPA031169.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ITGA2B antibody HPA031169.
Sample type: HUMAN