HPA022903

LRP1 antibody from Sigma-Aldrich
A2MR, APOER, APR, CD91, LRP, LRP1A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022903
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022903, RRID:AB_10602426
Product name
Anti-AC137834.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022903
Antibody type
Polyclonal
Antigen
Prolow-density lipoprotein receptor-related protein 1 Precursor (LRP)(Alpha-2-macroglobulin receptor)(A2MR)(Apolipoprotein E receptor)(APOER)(CD91 antigen) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCP
DGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMS
RLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHC
VPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGT
CSQLCTNTD
Storage
-20C
Provider Type Product Number
- No reagents -