HPA018156

CTSB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018156
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018156, RRID:AB_1846069
Product name
Anti-CTSB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018156
Antibody type
Polyclonal
Antigen
Cathepsin B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTF
LGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIK
EIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVE
VSAEDLLTCCGSMCGDGCNGGYPA
Storage
-20C
Provider Type Product Number
- No reagents -