Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001476-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001476-M02, RRID:AB_606102
- Product name
- CSTB monoclonal antibody (M02), clone M2-F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CSTB.
- Antigen sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKF
PVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF
QSLPHENKPLTLSNYQTNKAKHDELTYF- Isotype
- IgG
- Antibody clone number
- M2-F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CSTB monoclonal antibody (M02), clone M2-F1 Western Blot analysis of CSTB expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CSTB expression in transfected 293T cell line by CSTB monoclonal antibody (M02), clone M2-F1.Lane 1: CSTB transfected lysate(11 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CSTB on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CSTB on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol