Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001476-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001476-D01P, RRID:AB_1573208
- Product name
- CSTB purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CSTB protein.
- Antigen sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKF
PVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF
QSLPHENKPLTLSNYQTNKAKHDELTYF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CSTB expression in transfected 293T cell line (H00001476-T02) by CSTB MaxPab polyclonal antibody.Lane 1: CSTB transfected lysate(11.10 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CSTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CSTB expression in human placenta.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CSTB MaxPab rabbit polyclonal antibody. Western Blot analysis of CSTB expression in A-431.