HPA017380

CSTB antibody from Sigma-Aldrich
CST6, EPM1, PME, STFB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017380
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017380, RRID:AB_1847414
Product name
Anti-CSTB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017380
Antibody type
Polyclonal
Antigen
Cystatin-B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIK
VHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAK
HDELT
Storage
-20C
Provider Type Product Number
- No reagents -