Antibody data

Product number
H00006840-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006840-M03, RRID:AB_607127
Product name
SVIL monoclonal antibody (M03), clone 6E10
Provider product page
Abnova Corporation - H00006840-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SVIL.
Antigen sequence
LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVS
NQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPL
KLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKK
AKG
Isotype
IgG
Antibody clone number
6E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -