HPA020138

SVIL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020138, RRID:AB_1857681
Product name
Anti-SVIL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020138
Antibody type
Polyclonal
Antigen
Supervillin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NARYQTQPVTLGEVEQVQSGKLIPFSPAVNTSVST
VASTVAPMYAGDLRTKPPLDHNASATDYKFSSSIE
NSDSPVRSILKSQAWQPLVEGSENKGMLREYGETE
SKRALTGRDSGMEKYGSFEEAEASYPILNRARE
Storage
-20C
Provider Type Product Number
- No reagents -