Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29306 - Provider product page

- Provider
- Abnova Corporation
- Product name
- WDHD1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human WDHD1.
- Antigen sequence
QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCM
ERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNA
GDFLNDNAVE- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG sp cell lysate, Lane 3: A-431 cell lysate with WDHD1 polyclonal antibody(Cat# PAB29306) at 1:250 - 1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence staining of U-251 MG cells with WDHD1 polyclonal antibody (Cat# PAB29306) under 1-4 ug/mL working concentration.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach tissue with WDHD1 polyclonal antibody (Cat# PAB29306) at 1:50 - 1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)