HPA001122

WDHD1 antibody from Atlas Antibodies
AND-1, CHTF4, CTF4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001122
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001122, RRID:AB_1080589
Product name
Anti-WDHD1
Provider product page
Atlas Antibodies - HPA001122
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCM
ERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNA
GDFLNDNAVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -