HPA001122

WDHD1 antibody from Sigma-Aldrich
AND-1, CHTF4, CTF4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001122
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001122, RRID:AB_1080589
Product name
Anti-WDHD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001122
Antibody type
Polyclonal
Antigen
WD repeat and HMG-box DNA-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCM
ERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNA
GDFLNDNAVE
Storage
-20C
Provider Type Product Number
- No reagents -