Explore
Validate
LearnH00007852-M04
antibody from Abnova Corporation
Targeting: CXCR4
CD184, D2S201E, fusin, HM89, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007852-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007852-M04, RRID:AB_606115
- Product name
- CXCR4 monoclonal antibody (M04), clone 2G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CXCR4.
- Antigen sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENAN
FNKIFLPTIYS- Isotype
- IgG
- Antibody clone number
- 2G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Heteromerization of chemokine (C-X-C motif) receptor 4 with α1A/B-adrenergic receptors controls α1-adrenergic receptor function.
Tripathi A, Vana PG, Chavan TS, Brueggemann LI, Byron KL, Tarasova NI, Volkman BF, Gaponenko V, Majetschak M
Proceedings of the National Academy of Sciences of the United States of America 2015 Mar 31;112(13):E1659-68
Proceedings of the National Academy of Sciences of the United States of America 2015 Mar 31;112(13):E1659-68
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in RIN-m5F.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human intestinal wall.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M04), clone 2G9.Lane 1: CXCR4 transfected lysate (Predicted MW: 39.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
