H00007852-M03
antibody from Abnova Corporation
Targeting: CXCR4
CD184, D2S201E, fusin, HM89, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007852-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007852-M03, RRID:AB_606113
- Product name
- CXCR4 monoclonal antibody (M03), clone 2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CXCR4.
- Antigen sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENAN
FNKIFLPTIYS- Isotype
- IgG
- Antibody clone number
- 2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CXCR4 monoclonal antibody (M03), clone 2A9. Western Blot analysis of CXCR4 expression in human uterus myoma.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CXCR4 monoclonal antibody (M03), clone 2A9. Western Blot analysis of CXCR4 expression in human skeletal muscle.