H00007852-M01
antibody from Abnova Corporation
Targeting: CXCR4
CD184, D2S201E, fusin, HM89, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007852-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007852-M01, RRID:AB_464368
- Product name
- CXCR4 monoclonal antibody (M01), clone 2H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CXCR4.
- Antigen sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENAN
FNKIFLPTIYS- Isotype
- IgG
- Antibody clone number
- 2H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nuclear expression of CXCR4 is associated with advanced colorectal cancer.
Wang SC, Lin JK, Wang HS, Yang SH, Li AF, Chang SC
International journal of colorectal disease 2010 Oct;25(10):1185-91
International journal of colorectal disease 2010 Oct;25(10):1185-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M01), clone 2H5.Lane 1: CXCR4 transfected lysate(40.48 KDa).Lane 2: Non-transfected lysate.