Antibody data

Product number
H00009530-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009530-M02, RRID:AB_1203995
Product name
BAG4 monoclonal antibody (M02), clone 2G9
Provider product page
Abnova Corporation - H00009530-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant BAG4.
Antigen sequence
MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPP
LYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGD
GYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNS
TARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTY
PPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRS
SGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPS
QNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWAS
PGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPS
SGSPQSPPSPPVQQPKDSSYPYSQSDQSMNRHNFP
CSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN
ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIH
VLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKK
GL
Isotype
IgG
Antibody clone number
2G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -