H00009266-M02
antibody from Abnova Corporation
Targeting: CYTH2
ARNO, CTS18.1, cytohesin-2, PSCD2, PSCD2L, Sec7p-L, Sec7p-like
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009266-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009266-M02, RRID:AB_534996
- Product name
- CYTH2 monoclonal antibody (M02), clone 6H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CYTH2.
- Antigen sequence
VDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVE
GNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEM
LAARKKRISVKKKQE- Isotype
- IgG
- Antibody clone number
- 6H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression.
Mannell HK, Pircher J, Chaudhry DI, Alig SK, Koch EG, Mettler R, Pohl U, Krötz F
Cardiovascular research 2012 Jan 1;93(1):111-9
Cardiovascular research 2012 Jan 1;93(1):111-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CYTH2 monoclonal antibody (M02), clone 6H5 Western Blot analysis of CYTH2 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CYTH2 expression in transfected 293T cell line by CYTH2 monoclonal antibody (M02), clone 6H5.Lane 1: CYTH2 transfected lysate(46.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CYTH2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CYTH2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CYTH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol