Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30092 - Provider product page

- Provider
- Abnova Corporation
- Product name
- GABRP polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against synthetic peptide of human GABRP.
- Antigen sequence
VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQ
IALTLDIASISSISE- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of Jurkat cell lysate with GABRP polyclonal antibody (Cat # PAB30092) at 0.2-1 ug/mL working concentration.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of 293T cell lysate with GABRP polyclonal antibody (Cat # PAB30092) at 1 ug/mL working concentration.