HPA005830

L1CAM antibody from Sigma-Aldrich
CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005830
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005830, RRID:AB_1079219
Product name
Anti-L1CAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005830
Antibody type
Polyclonal
Antigen
Neural cell adhesion molecule L1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVRE
GGTMALSGISDFGNISATAGENYSVVSWVPKEGQC
NFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQW
DLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLP
PAGFATE
Storage
-20C
Provider Type Product Number
- No reagents -