Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000355-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000355-M05, RRID:AB_565565
- Product name
- FAS monoclonal antibody (M05), clone 2G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FAS.
- Antigen sequence
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHH
DGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGK
EYTDKAHFSSKCRRCRLCDEGHGLEVEINC- Isotype
- IgG
- Antibody clone number
- 2G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FAS expression in transfected 293T cell line by FAS monoclonal antibody (M05), clone 2G3.Lane 1: FAS transfected lysate(37.732 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FAS is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between FADD and FAS. HeLa cells were stained with anti-FADD rabbit purified polyclonal 1:1200 and anti-FAS mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
