H00000355-M03

FAS antibody from Abnova Corporation
APO-1, APT1, CD95, FAS1, TNFRSF6

Antibody data

Product number
H00000355-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000355-M03, RRID:AB_1204337
Product name
FAS monoclonal antibody (M03), clone 2D8
Provider product page
Abnova Corporation - H00000355-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FAS.
Antigen sequence
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHH
DGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGK
EYTDKAHFSSKCRRCRLCDEGHGLEVEINC
Isotype
IgG
Antibody clone number
2D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -