HPA027444

FAS antibody from Sigma-Aldrich
APO-1, APT1, CD95, FAS1, TNFRSF6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027444
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027444, RRID:AB_10601378
Product name
Anti-FAS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027444
Antibody type
Polyclonal
Antigen
Fas (TNF receptor superfamily, member 6) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKA
H
Storage
-20C
Provider Type Product Number
- No reagents -