HPA017925

BCL10 antibody from Sigma-Aldrich
c-E10, CARMEN, CIPER, CLAP, mE10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017925
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017925, RRID:AB_1845312
Product name
Anti-BCL10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017925
Antibody type
Polyclonal
Antigen
B-cell lymphoma/leukemia 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAE
RHFDHLRAKKILSREDTEEISCRT
Storage
-20C
Provider Type Product Number
- No reagents -