HPA017925

BCL10 antibody from Atlas Antibodies
c-E10, CARMEN, CIPER, CLAP, mE10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017925
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017925, RRID:AB_1845312
Product name
Anti-BCL10
Provider product page
Atlas Antibodies - HPA017925
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAE
RHFDHLRAKKILSREDTEEISCRT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -