Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034966 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA034966, RRID:AB_10795287
- Product name
- Anti-BRCA1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTEN
LIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPE
DFIKKADLAV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dual Mechanisms of LYN Kinase Dysregulation Drive Aggressive Behavior in Breast Cancer Cells
BRCA1 protein expression and subcellular localization in primary breast cancer: Automated digital microscopy analysis of tissue microarrays
Prioritization of Cancer Marker Candidates Based on the Immunohistochemistry Staining Images Deposited in the Human Protein Atlas
Tornillo G, Knowlson C, Kendrick H, Cooke J, Mirza H, Aurrekoetxea-RodrÃguez I, Vivanco M, Buckley N, Grigoriadis A, Smalley M
Cell Reports 2018;25(13):3674-3692.e10
Cell Reports 2018;25(13):3674-3692.e10
BRCA1 protein expression and subcellular localization in primary breast cancer: Automated digital microscopy analysis of tissue microarrays
Samant R, Mahmoud A, Macias V, Al-alem U, Deaton R, Kadjaksy-Balla A, Gann P, Rauscher G
PLOS ONE 2017;12(9):e0184385
PLOS ONE 2017;12(9):e0184385
Prioritization of Cancer Marker Candidates Based on the Immunohistochemistry Staining Images Deposited in the Human Protein Atlas
Chen C, Chiang S, Han C, Yu K, Chen Y, Wu K
PLoS ONE 2013;8(11):e81079
PLoS ONE 2013;8(11):e81079
No comments: Submit comment
No validations: Submit validation data