Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- LS-C388079 - Provider product page
- Provider
- LSBio
- Product name
- Anti-BMI1 / PCGF4 Antibody (aa135-165) LS-C388079
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR, aa135-165 of NP_005171.4). Percent identity by BLAST analysis: Human, Bat, Horse, Pig, Guinea pig (100%); Ferret, Sheep, Cat, Bovine, Elephant, Rabbit, Opossum, Platypus, Dog (97%); Hamster (90%); Mouse, Zebra finch, Xenopus (87%); Rat (74%).
- Description
- Immunoaffinity purified
- Reactivity
- Human, Mouse, Rat, Guinea Pig, Horse, Porcine
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 0.2ml
- Storage
- Prior to reconstitution, +4°C. Following reconstitution store at -20°C. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data