Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001020-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001020-M01A, RRID:AB_1016745
- Product name
- CDK5 monoclonal antibody (M01A), clone 1A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDK5.
- Antigen sequence
LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPS
MTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQ
NLLKCNPVQRISAEEALQHPYFSDFCPP- Isotype
- IgM
- Antibody clone number
- 1A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDK5 monoclonal antibody (M01A), clone 1A2. Western Blot analysis of CDK5 expression in human lung cancer.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CDK5 expression in transfected 293T cell line by CDK5 monoclonal antibody (M01A), clone 1A2.Lane 1: CDK5 transfected lysate (Predicted MW: 33.3 KDa).Lane 2: Non-transfected lysate.