Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406740 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cyclin-Dependent Kinase 5 (CDK5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDK5 antibody: synthetic peptide directed towards the N terminal of human CDK5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMAL
NHPYF NDLDNQIKKM- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cdk5-mediated regulation of the PIKE-A-Akt pathway and glioblastoma cell invasion.
Liu R, Tian B, Gearing M, Hunter S, Ye K, Mao Z
Proceedings of the National Academy of Sciences of the United States of America 2008 May 27;105(21):7570-5
Proceedings of the National Academy of Sciences of the United States of America 2008 May 27;105(21):7570-5
No comments: Submit comment
No validations: Submit validation data