HPA018977

CDK5 antibody from Sigma-Aldrich
PSSALRE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018977
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018977, RRID:AB_1846424
Product name
Anti-CDK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018977
Antibody type
Polyclonal
Antigen
Cell division protein kinase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVRLDDDDEGVPSSALREICLLKELKHKNIVRLHD
VLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIV
KSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNG
ELKL
Storage
-20C
Provider Type Product Number
- No reagents -