Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018977 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018977, RRID:AB_1846424
- Product name
- Anti-CDK5
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RVRLDDDDEGVPSSALREICLLKELKHKNIVRLHD
VLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIV
KSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNG
ELKL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CDK5 Regulates Paclitaxel Sensitivity in Ovarian Cancer Cells by Modulating AKT Activation, p21Cip1- and p27Kip1-Mediated G1 Cell Cycle Arrest and Apoptosis
Fei P, Zhang S, Lu Z, Mao W, Ahmed A, Yang H, Zhou J, Jennings N, Rodriguez-Aguayo C, Lopez-Berestein G, Miranda R, Qiao W, Baladandayuthapani V, Li Z, Sood A, Liu J, Le X, Bast R
PLOS ONE 2015;10(7):e0131833
PLOS ONE 2015;10(7):e0131833
No comments: Submit comment
No validations: Submit validation data