HPA007066

TAPBP antibody from Sigma-Aldrich
TAPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007066
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007066, RRID:AB_1857769
Product name
Anti-TAPBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007066
Antibody type
Polyclonal
Antigen
Tapasin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPA
TLARAAPGEAPPELLCLVSHFYPSGGLEVEWELRG
GPGGRSQKAEGQRWLSALRHHSDGSVSLSGHLQPP
PVTTEQHGARYACRIHHPS
Storage
-20C
Provider Type Product Number
- No reagents -