Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183713 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-PDZ and LIM Domain 5 (PDLIM5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the C terminal of human PDLIM5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSK
KDKPL CKKHAHSVNF- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The protein ENH is a cytoplasmic sequestration factor for Id2 in normal and tumor cells from the nervous system.
Lasorella A, Iavarone A
Proceedings of the National Academy of Sciences of the United States of America 2006 Mar 28;103(13):4976-81
Proceedings of the National Academy of Sciences of the United States of America 2006 Mar 28;103(13):4976-81
No comments: Submit comment
No validations: Submit validation data